PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_5160_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 335aa    MW: 38251.6 Da    PI: 5.0143
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_5160_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.81.2e-131461148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +g+W++eEd +l  ++ ++G  +W+  ++  g+ R++k+c++rw++yl
  cra_locus_5160_iso_3_len_1424_ver_3 14 KGAWSEEEDNKLRAYILRYGHWNWRQLPKFAGLARCGKSCRLRWLNYL 61
                                         79******************99************************97 PP

2Myb_DNA-binding57.92.3e-1867112148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                          rg+ T+eE+e +v+++++lG++ W++Ia++++ gRt++++k++w++++
  cra_locus_5160_iso_3_len_1424_ver_3  67 RGPITEEEEEMIVKLHEKLGNK-WSLIAAKLP-GRTDNEIKNYWHTHK 112
                                          8999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.382961IPR017930Myb domain
SuperFamilySSF466892.43E-2911108IPR009057Homeodomain-like
SMARTSM007171.3E-91363IPR001005SANT/Myb domain
PfamPF002492.0E-121461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-221568IPR009057Homeodomain-like
CDDcd001673.54E-81661No hitNo description
PROSITE profilePS5129426.21362116IPR017930Myb domain
SMARTSM007179.0E-1866114IPR001005SANT/Myb domain
PfamPF002493.2E-1667112IPR001005SANT/Myb domain
CDDcd001671.94E-1269112No hitNo description
Gene3DG3DSA:1.10.10.607.2E-2669114IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MVRSPSIDKN GLRKGAWSEE EDNKLRAYIL RYGHWNWRQL PKFAGLARCG KSCRLRWLNY  60
LKPGLKRGPI TEEEEEMIVK LHEKLGNKWS LIAAKLPGRT DNEIKNYWHT HKKKCKKSQD  120
PNSMVKTNAT PQNTHVMDQK DKQDSSISLS EVSTDYPNMD LIDDTCLQEN SLNSEESFPN  180
FCESFWTEIP VSPSTPISSS SSATSYNFSS VIDESFVKLF ESLSTEVQVP SMLPSTTAAR  240
IEDSNFQESS NDAFFSSFWT EPFLTNEPND LISPSTSSTT TTTACSTVTN LDEVFGSFWN  300
EPFVLDNHHH QLPSMDEGVP FTSYFYHDLD LFKQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C9e-24121142103C-Myb DNA-Binding Domain
1msf_C9e-24121142103C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A068UTL87e-73A0A068UTL8_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154